peptide Terlipressin to reduce the bleeding CAS NO.52232-67-4
- FOB Price: USD: 10.00-20.00 /Gram Get Latest Price
- Min.Order: 10 Gram
- Payment Terms: L/C,D/A,D/P,T/T,MoneyGram
- Available Specifications:
Top Grade(1-10)Gram Top Grade(10-50)Gram
- Product Details
Keywords
- Terlipressin
- Terlipressin
- Terlipressin
Quick Details
- ProName: peptide Terlipressin to reduce the ble...
- CasNo: 52232-67-4
- Molecular Formula: C172H278N52O47S2
- Appearance: White to off white powder
- Application: Pharmaceutical
- DeliveryTime: Within 7 working days
- PackAge: plastic tube/vials
- Port: Shanghai
- ProductionCapacity: 1000 Gram/Week
- Purity: ≥98%
- Storage: Store in a cool dry place and keep awa...
- Transportation: EMS,TNT,DHL
- LimitNum: 10 Gram
- Moisture Content: 0
- Impurity: 0
- Certification: GMP
- Molecular: 1031.17
- Specification: iu mg g kg
- Customized: Customized
Superiority
Superiority
1.As a professional production leading factory & lab in China in pharmaceutical area of 15 years, our market to USA, Australia, Middle East, Germany, Spain, UK, and so on other country. What’s more, good feedback from our customers. We had Established long friendly relations of cooperation.
2.High quality, best price, firstclass service, high successful delivery rate.
3.We have stock, so we can delivery quickly at the very day when receive the payment.
4.We will never sell, solicit,or give your information to any third parties. All transactions are confidential.Your satisfaction is guaranteed,as long as you have dissatisfaction,we will show our biggest sincerity and patience to solve problems.
5.We have the special way can ship 50 grams to 50kg products at a time. We can offer the melting powder into liquid service.And ship the liquid in the special bottles. According to your request and the quantity what you buy, we have several packaging methods for your choice. safety and quick shipping to you.
6.We can do ,TT and Money Gram wire transfer payment term.
Details
Description
Product Name: | Teriparatide acetate |
Synonyms: | PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (1-34) (HUMAN);PTH (HUMAN, 1-34);TERIPARATIDE;Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF |
CAS: | 52232-67-4 |
MF: | C172H278N52O47S2 |
MW: | 3890.49792 |
EINECS: | |
Product Categories: | Amino Acid Derivatives;Peptide;Hormones;Other Protein/Peptide Hormones;Parathyroid Hormone (PTH)Peptides and Proteins;Parathyroid Hormone Fragments;Peptides for Cell Biology;Peptides and Proteins;Various Peptides;EndocrinologyandHormones;proteins |
Mol File: | 52232-67-4.mol |
Terlipressin (trade names Teripress by New Medicon Pharma and Glypressin by Ferring Pharmaceuticals) is an analogue of vasopressin used as a vasoactive drug in the management of hypotension. It has been found to be effective when norepinephrine does not help.
Our process:
The quality control process
1)Purchasing
Thorough market research, understand the price of raw materials and performance.To the procurement source to understand fully, and fully guarantee the quality of the procurement of raw materials.
2) Inspection
Four steps: sampling, sample pretreatment, measuring and data processing.
3) Producing
a)Each operator must do self-inspection of producs and make the corresponding inspection records.
b)Full-time inspectors through check the operator self-inspection, and review and sign in the corresponding record. Full-time inspection is responsible for inspection of finished product, and make the finished product incoming inspection records.
4) Before selling
Test result can be provided before selling.
Third-party detection institution is allowed if you are not satisfied with test results.
Our advantages:
1. Quality:
Our company is a professional production of hormone intermediates for many years, our products have exported to Germany,Spain, UK, USA, Australia, Middle East, and so on other country, and we have got very good feedback from our customers, you can trust us.
And we are the manufactory, so no problem for us to control the quality.
2.Payment method: ,TT.
3.Service: Best service with after-sales service to all clients.
4.Delivery:
Sample Order :Package will be shipped with 3days after payment. We can send it via UP, EMS, HK Air Post, DHL or othermethod. We have a professional and stable logistics, and we can deliver the package smoothly around 3 to 5 days.