Sermorelin Acetate by lab CAS NO.86168-78-7
- FOB Price: USD: 5.00-10.00 /Gram Get Latest Price
- Min.Order: 1 Gram
- Payment Terms: L/C,D/A,D/P,T/T,
- Available Specifications:
high(1-100)Gramhigh(1-10)Gram98%(1-10)Gram97%(1-10)Gram
- Product Details
Keywords
- Sermorelin
- Sermorelin Acetate
- peptide
Quick Details
- ProName: Sermorelin Acetate by lab
- CasNo: 86168-78-7
- Molecular Formula: C149H246N44O42S
- Appearance: white powder
- Application: research by lab
- DeliveryTime: 2 years
- PackAge: 1kg/Aluminium foil bag or Customized
- Port: shanghai ,nanjing,hangzhou
- ProductionCapacity: 1 Metric Ton/Week
- Purity: 99%
- Storage: Store in a cool, dry and ventilated pl...
- Transportation: by air/express /sea
- LimitNum: 1 Gram
- Related Substances: 0%
- Residue on Ignition: 0%
- Heavy Metal: 0%
- Valid Period: 3 years
- Color: white
- Appearence: White Powder
- Grade: Medcine grade
- Categories:: steroid
Superiority
Filter is a global chemical industry manufacturers and suppliers of pharmaceuticals and intermediates in China.
2. The yearly production capacity is 50000MT, 80% for export.We have a professinal export team. Both by Air and by Sea,we ensure that we meet the customer expectations with promptness.
3. Our company facing global High-tech pharmaceutical raw materials, high complex new type intermediates, fine chemicals custom synthesis, scale-up production and Rare chemicals trade. Corey have well-equipped machine, strong technical force and considerate marketing team service.
4. We also have rich experience advantage in basic research, small scale process development, scale-up, industrial technology development & production and cost control.
Details
Product Name: | Generic Peptide Sermorelin Aceta |
Synonyms: | SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;GROWTH HORMONE RELEASING FACTOR (1-29), AMIDE, HUMAN;GRF (1-29) AMIDE (HUMAN) |
CAS: | 86168-78-7 |
MF: | C149H246N44O42S |
MW: | 3357.88 |
EINECS: | -- |
Product Categories: | Amino Acid Derivatives;Peptide;GH-RHObesity Research;GH-RHPeptides for Cell Biology;Growth Hormone Releasing Factors;Neuropeptides;Neurotransmission (Obesity);Releasing Factors |
Purity: | 99%,98% |
|
Sermorelin , also known as GHRH (1-29), is a growth hormone-releasing hormone (GHRH) analogue used as a diagnostic agent. It is a 29-amino acid polypeptide representing the 1–29 fragment from endogenous human GHRH, and is thought to be the shortest fully functional fragment of GHRH.It is used as a diagnostic agent to assess growth hormone (GH) secretion. It is also used as doping agent in sports due to its correlation with increased growth of muscular and skeletal tissue. Sermorelin use is also hypothesized to improve deep rapid eye movement sleep.
Uses
Sermorelin is used to treat growth problems (usually in children) due to growth hormone deficiency. It works by stimulating the pituitary gland to release more natural growth hormone.
<
Product Range |
Product Name English |
Testosterone Series | Testosterone base |
Testosterone Acetate | |
Testosterone Cypionate | |
Testosterone Decanoate | |
Testosterone Enanthate | |
Testosterone Phenylpropionate | |
Testosterone Propionate | |
Testosterone Isocaproate | |
Testosterone Undecanoate | |
Methyl Testosterone | |
Sustanon | |
Nandrolone Series | Nandrolone base |
Nandrolone Decanoate | |
Nandrolone Phenylpropionate | |
Nandrolone Uncecanoate | |
Nandrolone Enanthate | |
Nandrolone Cypionate | |
Nandrolone Propionate | |
Boldenone Series | Boldenone base |
Boldenone Undecylenate | |
Boldenone Acetate | |
Boldenone Cypionate | |
Boldenone Propionate | |
Trenbolone Series | Trenbolone base |
Trenbolone Acetate | |
Trenbolone Enanthate | |
Trenbolone Cyclohexylmethylcarbonate | |
Metribolone(Methyl Trenbolone) | |
Altrenogest(17a‐allyl‐trenbolone) | |
DHEA Series | DHEA Acetate |
DHEA | |
Epiandrosterone | |
7-keto DHEA | |
7-keto DHEA acetate | |
DHEA Sulphate Sodium | |
Metenolone Series | Metenolone Acetate |
Metenolone Enanthate | |
Other Products | 4AD(4-androstenedione) |
ADD(Androsta-1,4-diene-3,17-dione) | |
Oxymetholone | |
Stanozolol | |
Methandienone | |
Oxandrolone | |
Mesterolone | |
Fluoxymesterone | |
Estrogen | Estradiol |
Estriol | |
Estrone | |
Other Compounds | Methyl Drostanolone |
Drostanolone Propionate | |
Drostanolone Enanthate | |
Methylstenbolone | |
Non‐steroids | Clomifen |
Tamoxifen |
About us

Shipping
Cassie is here to give you my better service and producst
Whatsapp+8615294859659