Sermorelin Acetate by lab CAS NO.86168-78-7

Filter  is a global chemical industry manufacturers and suppliers of pharmaceuticals and intermediates in China.

2. The yearly production capacity is 50000MT, 80% for export.We have a professinal export team. Both by Air and by Sea,we ensure that we meet the customer expectations with promptness.
3. Our company facing global High-tech pharmaceutical raw materials, high complex new type intermediates, fine chemicals custom synthesis, scale-up production and Rare chemicals trade. Corey have well-equipped machine, strong technical force and considerate marketing team service.
4. We also have rich experience advantage in basic research, small scale process development, scale-up, industrial technology development & production and cost control.

Product Name:	Generic Peptide Sermorelin Aceta
Synonyms:	SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;GROWTH HORMONE RELEASING FACTOR (1-29), AMIDE, HUMAN;GRF (1-29) AMIDE (HUMAN)
CAS:	86168-78-7
MF:	C149H246N44O42S
MW:	3357.88
EINECS:	--
Product Categories:	Amino Acid Derivatives;Peptide;GH-RHObesity Research;GH-RHPeptides for Cell Biology;Growth Hormone Releasing Factors;Neuropeptides;Neurotransmission (Obesity);Releasing Factors
Purity:	99%,98%

Sermorelin , also known as GHRH (1-29), is a growth hormone-releasing hormone (GHRH) analogue used as a diagnostic agent. It is a 29-amino acid polypeptide representing the 1–29 fragment from endogenous human GHRH, and is thought to be the shortest fully functional fragment of GHRH.It is used as a diagnostic agent to assess growth hormone (GH) secretion. It is also used as doping agent in sports due to its correlation with increased growth of muscular and skeletal tissue. Sermorelin use is also hypothesized to improve deep rapid eye movement sleep.

 Uses

Sermorelin is used to treat growth problems (usually in children) due to growth hormone deficiency. It works by stimulating the pituitary gland to release more natural growth hormone.