CRF (human, rat) Acetate CAS NO.86784-80-7
- FOB Price: USD: 5.00-10.00 /Gram Get Latest Price
- Min.Order: 1 Gram
- Payment Terms: L/C,D/A,D/P,T/T,
- Available Specifications:
high(1-100)Gramhigh(1-10)Gram98%(1-10)Gram97%(1-10)Gram
- Product Details
Keywords
- CRF (human, rat) Acetate
- cosmetic peptide
- CORTICOTROPIN
Quick Details
- ProName: CRF (human, rat) Acetate
- CasNo: 86784-80-7
- Molecular Formula: C208H344N60O63S2
- Appearance: white powder
- Application: research by lab
- DeliveryTime: 2 years
- PackAge: 1kg/Aluminium foil bag or Customized
- Port: shanghai ,nanjing,hangzhou
- ProductionCapacity: 1 Metric Ton/Week
- Purity: 99%
- Storage: Store in a cool, dry and ventilated pl...
- Transportation: by air/express /sea
- LimitNum: 1 Gram
- Related Substances: 0%
- Residue on Ignition: 0%
- Heavy Metal: 0%
- Valid Period: 3 years
- Color: white
- Appearence: White Powder
- Grade: Medcine grade
- Categories:: steroid
Superiority
Filter is a global chemical industry manufacturers and suppliers of pharmaceuticals and intermediates in China.
2. The yearly production capacity is 50000MT, 80% for export.We have a professinal export team. Both by Air and by Sea,we ensure that we meet the customer expectations with promptness.
3. Our company facing global High-tech pharmaceutical raw materials, high complex new type intermediates, fine chemicals custom synthesis, scale-up production and Rare chemicals trade. Corey have well-equipped machine, strong technical force and considerate marketing team service.
4. We also have rich experience advantage in basic research, small scale process development, scale-up, industrial technology development & production and cost control.
Details
Product Name:
CRF (human, rat) Acetate | |
Synonyms: | SER-GLU-GLU-PRO-PRO-ILE-SER-LEU-ASP-LEU-THR-PHE-HIS-LEU-LEU-ARG-GLU-VAL-LEU-GLU-MET-ALA-ARG-ALA-GLU-GLN-LEU-ALA-GLN-GLN-ALA-HIS-SER-ASN-ARG-LYS-LEU-MET-GLU-ILE-ILE-NH2;SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2;CORTICOTROPIN RELEASING FACTOR;CORTICOTROPIN RELEASING FACTOR (CRF), HUMAN, RAT;CORTICOTROPIN RELEASING FACTOR, HUMAN;CORTICOTROPIN RELEASING FACTOR, HUMAN AND RAT;CORTICOTROPIN RELEASING FACTOR HUMAN, RAT;CRF, HUMAN AND RAT |
CAS: | 86784-80-7 |
MF: | C208H344N60O63S2 |
MW: | 4757.45 |
EINECS: | ----- |
Product Categories: | Peptide;CRF receptor and related;proteins |
Purity: | 99%, 98% |
Acetate corticotropin releasing factor CRF (human, rat) Acetate Acronym CRF. In the so-called pro-hormone releasing factor (RF), and was the first to affirm its existence (A.V.Schally et al., 1955), by the hypothalamus - pituitary neurosecretory system secreted into the pituitary portal system, it has a direct effect on the gland Royal pituitary adrenocorticotropic hormone (ACTH) secreting cells, promote the secretion of ACTH (alias corticotropin) of. There α1-, α2-, and β-CRF are three similar peptides, but the specific chemical nature is unclear. Also be extracted from the hypothalamus and pituitary nerve.
<
Product Range |
Product Name English |
Testosterone Series | Testosterone base |
Testosterone Acetate | |
Testosterone Cypionate | |
Testosterone Decanoate | |
Testosterone Enanthate | |
Testosterone Phenylpropionate | |
Testosterone Propionate | |
Testosterone Isocaproate | |
Testosterone Undecanoate | |
Methyl Testosterone | |
Sustanon | |
Nandrolone Series | Nandrolone base |
Nandrolone Decanoate | |
Nandrolone Phenylpropionate | |
Nandrolone Uncecanoate | |
Nandrolone Enanthate | |
Nandrolone Cypionate | |
Nandrolone Propionate | |
Boldenone Series | Boldenone base |
Boldenone Undecylenate | |
Boldenone Acetate | |
Boldenone Cypionate | |
Boldenone Propionate | |
Trenbolone Series | Trenbolone base |
Trenbolone Acetate | |
Trenbolone Enanthate | |
Trenbolone Cyclohexylmethylcarbonate | |
Metribolone(Methyl Trenbolone) | |
Altrenogest(17a‐allyl‐trenbolone) | |
DHEA Series | DHEA Acetate |
DHEA | |
Epiandrosterone | |
7-keto DHEA | |
7-keto DHEA acetate | |
DHEA Sulphate Sodium | |
Metenolone Series | Metenolone Acetate |
Metenolone Enanthate | |
Other Products | 4AD(4-androstenedione) |
ADD(Androsta-1,4-diene-3,17-dione) | |
Oxymetholone | |
Stanozolol | |
Methandienone | |
Oxandrolone | |
Mesterolone | |
Fluoxymesterone | |
Estrogen | Estradiol |
Estriol | |
Estrone | |
Other Compounds | Methyl Drostanolone |
Drostanolone Propionate | |
Drostanolone Enanthate | |
Methylstenbolone | |
Non‐steroids | Clomifen |
Tamoxifen |
About us
Shipping
Cassie is here to give you my better service and producst
Whatsapp+8615294859659
Related products
<
Name | purity | CAS |
Abarelix Acetate | 98% | 183552-38-7 |
Alarelin Acetate | 98% | 79561-22-1 |
Angiotensin Acetate | 98% | 58-49-1 |
Angiotensin II | 98% | 68521-88-0 |
Antide Acetate | 98% | 112568-12-4 |
Argpressin Acetate | 98% | 113-79-1 |
Argreline Acetate | 98% | 616204-22-9 |
Atosiban Acetate | 98% | 90779-69-4 |
Aviptadil Acetate | 98% | 40077-57-4 |
Bate-Amyloid(1-42)human | 95% | 107761-42-2 |
Bivalirudin Trifluoroacetate | 98% | 128270-60-0 |
Buserelin acetate | 98% | 57982-77-1 |
Calcuitonin | 9007/12/9 | |
Carbetocin Acetate | 98% | 37025-55-1 |
Carperitide | 98% | 89213-87-6 |
Cerropin B | 98% | |
Cetrorelix Acetate | 98% | 130143-01-0 |
Cetrorelix Acetate | 98% | 130143-01-0 |
CJC-1295 | 98% | 863288-34-0 |
Copper Peptide(GHK-Cu) | 98% | 49557-75-7 |
CRF (human, rat) Acetate | 98% | 86784-80-7 |
CRF (ovine) Trifluoroacetate | 98% | 79804-71-0 |
Deslorelin Acetate | 98% | 57773-65-6 |
Desmopressin Acetate | 98% | 16679-58-6 |
Dynorphin A (1-13) Acetate | 98% | 72957-38-1 |
Elcatonin Acetate | 98% | 60731-46-6 |
Eledoisin Acetate | 98% | 69-25-0 |
Endothelin-1 Acetate | 98% | 117399-94-7 |
Enfuvirtide Acetate (T-20) | 95% | 159519-65-0 |
Eptifibatide Acetate | 98% | 148031-34-9/188627-80-7 |
Exenatide Acetate | 98% | 141732-76-5 |
Felypressin Acetate | 98% | 56-59-7 |
Fertirelin Acetate | 98% | 38234-21-8 |
Ganirelix acetate | 98% | 123246-29-7 |
GHRP-2 Acetate | 98% | 158861-67-7 |
GHRP-6 Acetate | 98% | 87616-84-0 |
Glatiramer Acetate | 99% | 147245-92-9 |
GLP(7-36) | 98% | 107444-51-9 |
GLP-1 (7-37) Acetate | 98% | 106612-94-6 |
Glucagon Hydrochloride | 98% | 16941-32-5 |
Gonadorelin Acetate | 98% | 34973-08-5 |
Goserelin Acetate | 98% | 145781-92-6 |
GRF (human) Acetate | 98% | 83930-13-6 |
Hexarelin Acetate | 98% | 140703-51-1 |
Histrelin Acetate | 98% | 76712-82-8 |
Icatibant Acetate | 98% | 30308-48-4 |
Lanreotide | 98% | 108736-35-2 |
Lecirelin (Dalmarelin) Acetate | 98% | 61012-19-9 |
Leuprolide | 98% | 74381-53-6 |
Leuprorelin Acetate | 98% | 53714-56-0 |
Linaclotide Acatate | 98% | 851199-59-2 |
Lixisenatide | 98% | 320367-13-3 |
Lraglutide | 98% | 204656-20-2 |
Lysipressin Acetate | 98% | 50-57-7 |
Melanotan II Acetate | 98% | 121062-08-6 |
MOG(35-55) | 98% | 163913-87-9 |
Nafarelin Acetate | 98% | 76932-56-4 |
Nesiritide Acetate (BNP-32) | 98% | 114471-18-0 |
Octreotide | 98% | 79517-01-4 |
Ornipressin Acetate | 98% | 3397-23-7 |
Oxytocin Acetate | 98% | 50-56-6 |
Palmitoyl Pentapeptide | 98% | 214047-00-4 |
Pexiganan | 98% | 147664-63-9 |
Pramlintide Acetate | 98% | 196078-30-5 |
Pretirelin | ||
PT141 Acetate | 98% | 32780-32-8 |
Salmon Calcitonin Acetate | 98% | 47931-85-1 |
Secretin Acetate | 98% | 10813-74-8 |
Sermorelin Aceta | 98% | 86168-78-7 |
Sincalide | 98% | 25126-32-3 |
Somatostatin Acetate | 98% | 38916-34-6 |
Splenopentin Acetate | 98% | 105184-37-0 |
Taltirelin Acetate | 98% | 103300-74-9 |
Teriparatide Acetate | 98% | 52232-67-4 |
Teriparatide Acetate | 98% | 52232-67-4 |
Terlipressin Acetate | 98% | 14636-12-5 |
Tetracosactide Acetate | 98% | 16960-16-0 |
Thymalfasin | 98% | 62304-98-7 |
Thymopentin | 98% | 69558-55-0 |
Thymosin α1 Acetate | 98% | 14636-12-5 |
Thymosin β4 Acetate | 98% | 77591-33-4 |
Triptorelin Acetate | 98% | 57773-63-4 |
Vapreotide Acetate | 98% | 103222-11-3 |
Vasopressin Acetate | 98% | 9034-50-8 |
Ziconotide Acetate | 98% | 107452-89-1 |