China (Mainland)
Crf (human, rat) Acetate; Generic Peptide; Cosmetic Peptide CAS NO.86784-80-7
- FOB Price: USD: 15.00-15.00 /Gram Get Latest Price
- Min.Order: 1 Gram
- Payment Terms: T/T,Other
- Available Specifications:
pharmaceutical grade(1-1000)Gram
- Product Details
Keywords
- Peptides
- Pharmaceutical Intermediate
- Chemical
Quick Details
- ProName: Crf (human, rat) Acetate; Generic Pept...
- CasNo: 86784-80-7
- Molecular Formula: C208h344n60o63s2
- Appearance: White Powder
- Application: bodybuilding pharmaceutical material, ...
- DeliveryTime: 3days
- PackAge: Packaging can be according to customer
- Port: Shanghai
- ProductionCapacity: 10000 Metric Ton/Day
- Purity: 99%
- Storage: Keep it under seal in cool and dark pl...
- Transportation: FEDEX DHL TNT UPS EUB
- LimitNum: 1 Gram
- Related Substances: Peptides
- Residue on Ignition: 0
- Heavy Metal: 0
- Valid Period: 2years
- CasNo: 86784-80-7
- Molecular Formula: C208h344n60o63s2
- Appearance: detailed see specifications
- Purity: 99%
- Grade: Grade
- LimitNum: 1 Gram
Superiority
This is Allen from Zhengzhou Filter Biotechnology Co.,Ltd.We are the professional supplier of peptide products in China over 10 years. we have Professional Lab to confirm the Quality and Serive for all clients in long-term run cooperation.
Our Company as a Pharmaceutical Raw Material Manufacturer specialize in R&D the New Drugs and Producing the Generic Medicine:
Amino Acids&Vitamins
Pharmaceutical Polypeptide,
Comestic Polypeptide,
Veterinary Peptide and
Pharmaceutical APIs.
Due to of the high quality and good service, They have been exported more than 30 countries.
Sincerely hope to have a chance to cooperate with you
Details
Description
CRF (human rat) Acetate
Sequence: Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2
Form: White powder
Biological Activity
Endogenous peptide agonist for the CRF receptor (Ki values are 11, 44 and 38 nM for hCRF1, rCRF2aand mCRF2b respectively). Stimulates the synthesis and release of ACTH from the anterior pituitary.
Licensing Information
Sold with the permission of the SALK Institute
Technical Data
M.Wt:
4758
Formula:
C208H344N60O63S2
Sequence:
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII
(Modifications: Ile-41 = C-terminal amide)
Solubility:
Soluble to 1.10 mg/ml in water
Storage:
Desiccate at -20°C
CAS No:
86784-80-7
The technical data provided above is for guidance only.
For batch specific data refer to the Certificate of Analysis.