China (Mainland)
Best Quality Calcuitonin CAS NO.9007-12-9
- FOB Price: USD: 8.00-8.00 /Milligram Get Latest Price
- Min.Order: 50 Milligram
- Payment Terms: L/C,D/A,D/P,T/T,
- Available Specifications:
Pharmaceutical (0-50)Milligram
- Product Details
Keywords
- Calcuitonin
- Salmon
- Calcimar
Quick Details
- ProName: Best Quality Calcuitonin
- CasNo: 9007-12-9
- Molecular Formula: C400H625N111O115S9
- Appearance: White Crystal Powder
- Application: Endocrine and metabolic regulation Ind...
- DeliveryTime: 24 hours
- PackAge: According to Customer's Requirement
- Port: Shanghai
- ProductionCapacity: 10 Gram/Day
- Purity: 99.4%
- Storage: Keep Cold
- Transportation: Shipment : TNT ,DHL ,HKEMS ,HKEUB ,FED...
- LimitNum: 50 Milligram
- Related Substances: Calcuitonin
- Residue on Ignition: 0
- Heavy Metal: 0
- Valid Period: 2 years
- Storage: Store the shade
- Function: Muscle Building
Superiority
Quality
Our company is a professional production of hormone intermediates for many years, our products have exported to Germany,Spain, UK, USA, Australia, Middle East, and so on other country, and we have got very good feedback from our customers, you can trust us.And we are the manufactory, so no problem for us to control the quality.
Payment Method
Western Union,TT,Money Gram
Service
Best service with after-sales service to all clients.
Delivery
Sample Order :Package will be shipped with 3days after payment. We can send it via UP, EMS, HK Air Post, DHL or othermethod. We have a professional and stable logistics, and we can deliver the package smoothly around 3 to 5 days.
Details
Best Quality Calcuitonin
More about Calcitonin
CAS:9007-12-9
Synonyms:calcimar(salmon);calcitar;calcitrin;CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2;CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2 SALMON;CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2;CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (DISULFIDE BRIDGE: 1-7);CALCITONIN (SALMON I)
Molecular formula:C145H240N44O48S2
Use of Calcitonin
For bone pain associated with osteoporosis, hypercalcemia and crisis, secondary to breast, lung, kidney and other cancer-induced tumor osteolysis, Paget's disease, neurological disease of malnutrition, acute pancreatitis.
------Product Description------
The role of calcitonin is mainly through the bone, gastrointestinal and renal regulation of calcium decreased.
-----Company Info------
Filter Biotechnology Co., Ltd is a High-Tech Bio-Chemical Enterprise which is integrated by Professional Scientific R&D, Mass production and Sales. As a world-leading Provider of Peptide Reagents, Generic Peptides and Custom Peptide Synthesis Services., it has been faithfully serving the Biotech and Pharmaceutical Industries, as well as well as life science research institutes, Universities and Medical Cosmetology Organization worldwide.
In accordance with Relevant Regulations in China, , xxx certified with GMP Certification, actively implemented international Quality Standards and established a perfect Quality Management System.
With the linking Enterprise Quality Assurance Agences and conscientious Quality Standard Audit Systems, it could gurantee the Good Quality on the Production Process and the Finished goods.
Insisting on Faith, Mutual Beneficial Cooperation and Professional, conscientious and efficient work practices and combining the Excellent Inner Techniques and External Resources, XXX fully respect on Clients requirements to actively offer Highly Standard, Specialiezed and Professional Services around the world .
-----Lab-----
-----Contact US -----
Krystal
Phone :0086-15737953140
Facebook :calarhan1993@126.com
Skype :calarhan1993@126.com