Products Categories
    Product Certification&
    Enterprise Certification

  • Ms.Krystal
    Sales
    Tel: 0371-86538623

  • Mobile:0086-15737953140
  • Tel:0371-86538623
  • Fax:0371-86538623
  • Province/state:Henan
  • City:Zhengzhou
  • Street:South of Nongye Rd. Zhengdong New District,Zhengzhou
  • MaxCard:
Home > Products >  Best Quality Calcuitonin

Best Quality Calcuitonin CAS NO.9007-12-9

  • FOB Price: USD: 8.00-8.00 /Milligram Get Latest Price
  • Min.Order: 50 Milligram
  • Payment Terms: L/C,D/A,D/P,T/T,
  • Available Specifications:

    Pharmaceutical (0-50)Milligram

  • Product Details

Keywords

  • Calcuitonin
  • Salmon
  • Calcimar

Quick Details

  • ProName: Best Quality Calcuitonin
  • CasNo: 9007-12-9
  • Molecular Formula: C400H625N111O115S9
  • Appearance: White Crystal Powder
  • Application: Endocrine and metabolic regulation Ind...
  • DeliveryTime: 24 hours
  • PackAge: According to Customer's Requirement
  • Port: Shanghai
  • ProductionCapacity: 10 Gram/Day
  • Purity: 99.4%
  • Storage: Keep Cold
  • Transportation: Shipment : TNT ,DHL ,HKEMS ,HKEUB ,FED...
  • LimitNum: 50 Milligram
  • Related Substances: Calcuitonin
  • Residue on Ignition: 0
  • Heavy Metal: 0
  • Valid Period: 2 years
  • Storage: Store the shade
  • Function: Muscle Building

Superiority

Quality

Our company is a professional production of hormone intermediates for many years, our products have exported to Germany,Spain, UK, USA, Australia, Middle East, and so on other country, and we have got very good feedback from our customers, you can trust us.And we are the manufactory, so no problem for us to control the quality.

Payment Method

Western Union,TT,Money Gram 

Service 

Best service with after-sales service to all clients.

Delivery

Sample Order :Package will be shipped with 3days after payment. We can send it via UP, EMS, HK Air Post, DHL or othermethod. We have a professional and stable logistics, and we can deliver the package smoothly around 3 to 5 days.

 

Details

Best Quality Calcuitonin 

More about  Calcitonin

CAS:9007-12-9

Synonyms:calcimar(salmon);calcitar;calcitrin;CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2;CYS-SER-ASN-LEU-SER-THR-CYS-VAL-LEU-GLY-LYS-LEU-SER-GLN-GLU-LEU-HIS-LYS-LEU-GLN-THR-TYR-PRO-ARG-THR-ASN-THR-GLY-SER-GLY-THR-PRO-NH2 SALMON;CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2;CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (DISULFIDE BRIDGE: 1-7);CALCITONIN (SALMON I)

Molecular formula:C145H240N44O48S2

Use of Calcitonin

For bone pain associated with osteoporosis, hypercalcemia and crisis, secondary to breast, lung, kidney and other cancer-induced tumor osteolysis, Paget's disease, neurological disease of malnutrition, acute pancreatitis.

------Product Description------

The role of calcitonin is mainly through the bone, gastrointestinal and renal regulation of calcium decreased.

① on the role of bone: osteoclasts can inhibit bone osteolysis, inhibition of bone resorption and bone to prevent bone destruction. Due to inhibition of bone dissolution, so that excessive increase in serum calcium decreased. But also inhibit the dissolution and metastasis of bone salt, inhibit bone decomposition, improve bone turnover rate, increase urinary calcium, urinary phosphorus excretion, causing hypocalcemia or hypophosphatemia, in the body to reduce blood calcium is very short. This product also against the role of parathyroid hormone on bone.
② the role of the gastrointestinal tract: can inhibit intestinal transit calcium, inhibit gastric acid, gastrin and insulin secretion. Other can also inhibit the thyroid stimulating hormone, luteinizing hormone and growth hormone secretion.
③ the role of the kidneys: by reducing renal tubular reabsorption, so that urinary calcium, phosphorus, sodium excretion increased, but will not make blood calcium below normal range, the impact of potassium and hydrogen ions is small.
Clinical calcitonin available in the treatment of Paget's disease (Paget disease), senile osteoporosis, hypercalcemia and hyperphosphatemia.

-----Company Info------ 

Filter Biotechnology Co., Ltd is a High-Tech Bio-Chemical Enterprise which is integrated by Professional Scientific R&D, Mass production and Sales. As a world-leading Provider of Peptide Reagents, Generic Peptides and Custom Peptide Synthesis Services., it has been faithfully serving the Biotech and Pharmaceutical Industries, as well as well as life science research institutes, Universities and Medical Cosmetology Organization worldwide. 

In accordance with Relevant Regulations in China, , xxx certified with GMP Certification, actively implemented international Quality Standards and established a perfect Quality Management System. 

With the linking Enterprise Quality Assurance Agences and conscientious Quality Standard Audit Systems, it could gurantee the Good Quality on the Production Process and the Finished goods. 

Insisting on Faith, Mutual Beneficial Cooperation and Professional, conscientious and efficient work practices and combining the Excellent Inner Techniques and External Resources, XXX fully respect on Clients requirements to actively offer Highly Standard, Specialiezed and Professional Services around the world .

-----Lab-----

-----Contact US -----

Krystal 

Phone :0086-15737953140

Facebook :calarhan1993@126.com

Skype :calarhan1993@126.com

 

Other products of this supplier

lookchemhot product CAS New CAS Cas Database Article Data Chemical Catalog