Products Categories
    Product Certification&
    Enterprise Certification

  • Mr.Mr.Zhao Yong
    Tel: 0086-18503829707

  • Ms.Krystal
    Sales
    Tel: 0371-86538623

  • Ms.Amy Xue
    sales
    Tel: 13523754278

  • Ms.Betty
    Sales
    Tel: 15713695780

  • Ms.Bella
    Sales
    Tel: 0371-86538623

  • Ms.Eva Liu
    Sales
    Tel: +86-0371-86538623

  • Mr.Allen
    Saler
    Tel: 0371-8653 8623

  • Ms.Katherine
    Sales
    Tel: +8615517251602

  • Ms.Ryna Ren
    sales
    Tel: 13636480834

  • Ms.Salina Mao
    Tel: 13140192019

  • Mobile:0086-18503829707
  • Tel:0086-18503829707
  • Fax:0371-86538623
  • Province/state:Henan
  • City:Zhengzhou
  • Street:South of Nongye Rd. Zhengdong New District,Zhengzhou
  • MaxCard:
Home > Products >  CJC1294 with DAC

CJC1294 with DAC

  • msdsMSDS/COA Download

  • FOB Price: USD: 12.00-15.00 /Gram Get Latest Price
  • Min.Order: 10 Gram
  • Payment Terms: L/C,D/A,D/P,T/T,
  • Available Specifications:

    Top Grade(10-50)Gram Top Grade(50-100)Gram

  • Product Details

Keywords

  • CJC1294 with DAC base powder
  • CJC1294 with DAC base raw powder
  • CJC1294 with DAC base ?Injection

Quick Details

  • ProName: CJC1294 with DAC
  • Molecular Formula: C18H22O2
  • Appearance: White to off white powder
  • Application: can be used as pharmaceutical materia...
  • DeliveryTime: Within 7 working days
  • PackAge: Icebag, Discreet Packing ways for your...
  • Port: Shanghai
  • ProductionCapacity: 1000 Gram/Day
  • Purity: 98%
  • Storage: Store in a cool dry place and keep awa...
  • Transportation: EMS, DHL, FedEx, UPS
  • LimitNum: 10 Gram
  • Related Substances: Trenbolone base
  • Residue on Ignition: 0
  • Heavy Metal: 0
  • Valid Period: 1 year
  • Molecular Formula: C18H22O2
  • Appearance: Yellow crystalloid powder.
  • DeliveryTime: prompt after payment
  • PackAge: ?safe pckage methods

Superiority

Superiority

1.As a professional production leading factory & lab in China in pharmaceutical area of 15 years, our market to USA, Australia, Middle East, Germany, Spain, UK, and so on other country. What’s more, good feedback from our customers. We had Established long friendly relations of cooperation.

2.High quality, best price, firstclass service, high successful delivery rate.

3.We have stock, so we can delivery quickly at the very day when receive the payment.

4.We will never sell, solicit,or give your information to any third parties. All transactions are confidential.Your satisfaction is guaranteed,as long as you have dissatisfaction,we will show our biggest sincerity and patience to solve problems.

5.We have the special way can ship 50 grams to 50kg products at a time. We can offer the melting powder into liquid service.And ship the liquid in the special bottles. According to your request and the quantity what you buy, we have several packaging methods for your choice. safety and quick shipping to you.

6.We can do ,TT and Money Gram wire transfer payment term.

Details

Product Description
 

Product Name: CJC1295
Synonyms: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide;CJC-1295 Acetate;CJC1295 with out DAC
CAS: 863288-34-0

 

CJC1295 is a tetrasubstituted peptide of 29 amino acid length, primarily functioning as a releasing hormone (GHRH) analog. It was invented by a Canadian biotechnology company. CJC1295 is a synthetic human GHRH analog that binds to endogenous albumin after subcutaneous administration, extending its half-life and therapeutic window. CJC1295 has been reported to increase plasma  concentations by 2-10X for more than 7 days and increased concentrations for up to 28 days.
 

.Competitive Advantage:
1.High quality with competitive price:
2.Standard: Enterprise Standard
3.All Purity≥99%
4.We are manufacturer and can provide high quality products with factory price
5. Service: Reply quickly ,Tracking number ,Status updates ,Receiving remind ,Good after-sales service.

Other products of this supplier

lookchemhot product CAS New CAS Cas Database Article Data Chemical Catalog