Products Categories
    Product Certification&
    Enterprise Certification

  • Mr.Allen
    Saler
    Tel: 0371-8653 8623

  • Mobile:+86 185 0382 9707
  • Tel:0371-8653 8623
  • Fax:0371-86538623
  • Province/state:Henan
  • City:Zhengzhou
  • Street:South of Nongye Rd. Zhengdong New District,Zhengzhou
  • MaxCard:
Home > Products >  Pharmaceutical Peptide Top Quality Ig-1 Lr3

Pharmaceutical Peptide Top Quality Ig-1 Lr3 CAS NO.946870-92-4

  • FOB Price: USD: 15.00-15.00 /Gram Get Latest Price
  • Min.Order: 1 Gram
  • Payment Terms: T/T,Other
  • Available Specifications:

    pharmaceutical grade(1-1000)Gram

  • Product Details

Keywords

  • Peptides
  • 946870-92-4
  • Pharmaceutical Intermediate

Quick Details

  • ProName: Pharmaceutical Peptide Top Quality Ig-...
  • CasNo: 946870-92-4
  • Molecular Formula: C30H44O3
  • Appearance: White Powder
  • Application: bodybuilding pharmaceutical material, ...
  • DeliveryTime: 3days
  • PackAge: Packaging can be according to customer
  • Port: Shanghai
  • ProductionCapacity: 10000 Metric Ton/Day
  • Purity: 99%
  • Storage: Keep it under seal in cool and dark pl...
  • Transportation: FEDEX DHL TNT UPS EUB
  • LimitNum: 1 Gram
  • Related Substances: Steriods
  • Residue on Ignition: 0
  • Heavy Metal: 0
  • Valid Period: 2years
  • CasNo: 946870-92-4
  • Molecular Formula: C400h625n111o115s9
  • Appearance: detailed see specifications
  • Purity: 99%
  • Grade: Grade
  • LimitNum: 1 Gram

Superiority

This is Allen  from Zhengzhou Filter Biotechnology Co.,Ltd.We are the professional supplier of peptide products in China over 10 years. we have Professional Lab to confirm the Quality and Serive for all clients in long-term run cooperation.
Our Company as a Pharmaceutical Raw Material Manufacturer specialize in R&D the New Drugs and Producing the Generic Medicine:

Amino Acids&Vitamins
Pharmaceutical Polypeptide,
Comestic Polypeptide,
Veterinary Peptide and 
Pharmaceutical APIs.
Due to of the high quality and good service, They have been exported more than 30 countries. 
Sincerely hope to have a chance to cooperate with you

Details

Pr

Quick Details


Description  

IG LR3, also known as Long-Arginine-3 is an analogue of human  that has been modified to include a 13 amino acid N-terminus extension and the substitution of Arginine for Glutamic Acid at position 3. As a result of these modifications, IG LR3 is approximately three times more potent than IF-1 and possesses an increased half-life due to lowered affinity for binding to the Insulin-Like-Binding Proteins (BPs). IF-1 LR3 retains the ability to bind agonistically to the receptor with improved metabolic stability, relative to I -1. The supplementation of mammalian cell cultures with Long R3 IF-1 at a much lower concentration results in more highly elevated productivity than with standard concentrations of insulin and/or standard I-1. IG1 LR3 is more able to stimulate the type 1 IF receptor and thus induce a higher level of activation of intracellular signaling, which is responsible for promoting cell proliferation and the inhibition of apoptosis.


Specification
Name: IG LR3
CAS No.: 946870-92-4
Molecular Formula: C400H625N111O115S9
Molecular Mass: 9117.5 Da (g/mol)
Amino Acid Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA


Purity
IG-1 LR3 has a peptide purity level that exceeds 95.0% as determined by HPLC and MS.


Usage
The polypeptide Long R3  (IG1 LR3) is an 83 amino acid analog of IG-I actually comprising the complete IG-1 sequence but with the substitution of an Arginine (Arg) for the Glutamic Acid (Glu) at position 3, as well as a 13 amino acid extension peptide. This sequence change causes IG-1 LR3 to avoid binding to proteins and allow it to have a much longer half life, around 20-30 hours. This analog of IG-1 has been produced with the purpose of increasing the biological activity of the IG peptide." . Among the effects the most positive are increased amino acid transport to cells, increased glucose transport, increased protein synthesis, and decreased protein degradation. When IGis active it behaves differently in different types of tissues. In muscle cells proteins and associated cell components are stimulated. Protein synthesis is increased along with amino acid absorption. As a source of energy, IG-1 LR3 mobilizes fat for use as energy in adipose tissue. In lean tissue, IF-1 LR3 prevents from transporting glucose across cell membranes. As a result the cells have to switch to burning off fat as a source of energy.

IG-1 LR3 builds new muscle tissue by promoting nitrogen retention and protein synthesis. This causes the growth of muscles through both hyperplasia (which is an increase in number of muscle cells) and mitogenesis (which is the actual growth of new muscle fibers). Thus IG-1 LR3 not only makes muscle fibers bigger, it makes more of them as well. Therefore, IG can actually change the genetic capabilities in terms of muscle tissue and cell count. IG increases and differentiates the number and types of cells present.

IF-1 LR3 is a synthetic analog of the naturally existing  which is a 93 amino acid residue. Modifications of the natural form occurred with the substitution of the Arg with Glu at the position 3, giving a code R3, and also an extension of a 13 amino acid at the B-terminus. Just like IG-1, R3 has been shown to induce the development and  of cells.

The studies on transgenic and knockout mice have shown that it can control its development and growth. It plays an important role as regulator in the G1 to S phase of the cell cycle. When applied to cardiomyocyte cultures, R3 have shown a large increase in proliferating cell nuclear antigen expression and in several cyclins involved in cell progression as well as in bromodeoxyuridien (BrdU) labeling (Kajstura et al. 1994). Other effects it has on cell lines are increased cell survival, inhibition of the apoptotic pathways, culture longevity and increased recombination of protein production (Fang et al. 1997). In another study, the application of the LR3 has led to an increase in the myocyte bromodeoxyuridine uptake by three to fivefold. But it has also shown that  LR3 actions have been blocked by the ERK and P13K labeling which completely abolished the BrdU uptake. Furthermore, ut has been shown that in mycocytes,  R3 stimulates the cardiomyocyte division in vivo (Sundgren et al. 2003). It has also been suggested that -Long 3R is more potent than the IG-1 because of its low binding capacity with all known  binding proteins (Tomas et al. 1995). In another investigation, feeding of LR3-1 in different amounts to investigate the effects on somatotropic axis (plasma levels of and 2, BPs) was done. They have reported that plasma Long-R3 increased when administered subcutaneously but with no such behavior when administered orally. Furthermore, LR3 lowered the levels of native IG-1 in rbGH-injected in calves, but L-R3 increased the amounts of IG-II concentrations when administered with L-R3 subcutaneously. The parenteral administration of the Long R3 IG-1 decreased the  concentration but did not affect the secretory system. It was also reported that the somatotrophic acis is basically functioning in neonatal calves and can be influenced by nutrition, growth hormone and Long-R3-). (Hammon and Blum 1997).

 

Other products of this supplier

lookchemhot product CAS New CAS Cas Database Article Data Chemical Catalog